Anti RAC1 pAb (ATL-HPA047820)

Atlas Antibodies

SKU: ATL-HPA047820-25

• 
• 

Protein Description: ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
Gene Name: RAC1
Alternative Gene Name: p21-Rac1, Rac-1, TC-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018012: 100%, ENSRNOG00000048172: 100%
Entrez Gene ID: 5879
Uniprot ID: P63000
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREI
• Gene Sequence: TKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREI
• Gene ID - Mouse: ENSMUSG00000018012
• Gene ID - Rat: ENSRNOG00000048172
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAC1 pAb (ATL-HPA047820) – 1 Found

Huang, Siyuan; Wei, Yong-Kai; Kaliamurthi, Satyavani; Cao, Yanghui; Nangraj, Asma Sindhoo; Sui, Xin; Chu, Dan; Wang, Huan; Wei, Dong-Qing; Peslherbe, Gilles H; Selvaraj, Gurudeeban; Shi, Jiang. Circulating miR-1246 Targeting UBE2C, TNNI3, TRAIP, UCHL1 Genes and Key Pathways as a Potential Biomarker for Lung Adenocarcinoma: Integrated Biological Network Analysis. Journal Of Personalized Medicine. 2020;10(4)