Anti RABIF pAb (ATL-HPA054936)

Atlas Antibodies

SKU:
ATL-HPA054936-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules & cytokinetic bridge.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAB interacting factor
Gene Name: RABIF
Alternative Gene Name: mss4, RASGRF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042229: 97%, ENSRNOG00000045814: 94%
Entrez Gene ID: 5877
Uniprot ID: P47224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
Gene Sequence GDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
Gene ID - Mouse ENSMUSG00000042229
Gene ID - Rat ENSRNOG00000045814
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RABIF pAb (ATL-HPA054936)
Datasheet Anti RABIF pAb (ATL-HPA054936) Datasheet (External Link)
Vendor Page Anti RABIF pAb (ATL-HPA054936) at Atlas Antibodies

Documents & Links for Anti RABIF pAb (ATL-HPA054936)
Datasheet Anti RABIF pAb (ATL-HPA054936) Datasheet (External Link)
Vendor Page Anti RABIF pAb (ATL-HPA054936)