Anti RAB43 pAb (ATL-HPA060085 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060085-25

• 

Protein Description: RAB43, member RAS oncogene family
Gene Name: RAB43
Alternative Gene Name: ISY1, RAB11B, RAB41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030055: 82%, ENSRNOG00000037768: 82%
Entrez Gene ID: 339122
Uniprot ID: Q86YS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGW
• Gene Sequence: EAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGW
• Gene ID - Mouse: ENSMUSG00000030055
• Gene ID - Rat: ENSRNOG00000037768
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.