Anti RAB3A pAb (ATL-HPA003160)

Atlas Antibodies

Catalog No.:
ATL-HPA003160-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAB3A, member RAS oncogene family
Gene Name: RAB3A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111277: 99%, ENSRNOG00000019433: 99%
Entrez Gene ID: 5864
Uniprot ID: P20336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQV
Gene Sequence RIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQV
Gene ID - Mouse ENSMUSG00000111277
Gene ID - Rat ENSRNOG00000019433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAB3A pAb (ATL-HPA003160)
Datasheet Anti RAB3A pAb (ATL-HPA003160) Datasheet (External Link)
Vendor Page Anti RAB3A pAb (ATL-HPA003160) at Atlas Antibodies

Documents & Links for Anti RAB3A pAb (ATL-HPA003160)
Datasheet Anti RAB3A pAb (ATL-HPA003160) Datasheet (External Link)
Vendor Page Anti RAB3A pAb (ATL-HPA003160)
Citations for Anti RAB3A pAb (ATL-HPA003160) – 1 Found
Frick, Petra; Sellier, Chantal; Mackenzie, Ian R A; Cheng, Chieh-Yu; Tahraoui-Bories, Julie; Martinat, Cecile; Pasterkamp, R Jeroen; Prudlo, Johannes; Edbauer, Dieter; Oulad-Abdelghani, Mustapha; Feederle, Regina; Charlet-Berguerand, Nicolas; Neumann, Manuela. Novel antibodies reveal presynaptic localization of C9orf72 protein and reduced protein levels in C9orf72 mutation carriers. Acta Neuropathologica Communications. 2018;6(1):72.  PubMed