Anti RAB33B pAb (ATL-HPA048367)

Atlas Antibodies

SKU:
ATL-HPA048367-25
  • Immunohistochemical staining of human stomach, lower shows distinct cytoplasmic positivity in superficial layer of glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RAB33B, member RAS oncogene family
Gene Name: RAB33B
Alternative Gene Name: DKFZP434G099
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027739: 87%, ENSRNOG00000013035: 89%
Entrez Gene ID: 83452
Uniprot ID: Q9H082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV
Gene Sequence MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV
Gene ID - Mouse ENSMUSG00000027739
Gene ID - Rat ENSRNOG00000013035
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RAB33B pAb (ATL-HPA048367)
Datasheet Anti RAB33B pAb (ATL-HPA048367) Datasheet (External Link)
Vendor Page Anti RAB33B pAb (ATL-HPA048367) at Atlas Antibodies

Documents & Links for Anti RAB33B pAb (ATL-HPA048367)
Datasheet Anti RAB33B pAb (ATL-HPA048367) Datasheet (External Link)
Vendor Page Anti RAB33B pAb (ATL-HPA048367)