Anti RAB33B pAb (ATL-HPA048367)
Atlas Antibodies
- SKU:
- ATL-HPA048367-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RAB33B
Alternative Gene Name: DKFZP434G099
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027739: 87%, ENSRNOG00000013035: 89%
Entrez Gene ID: 83452
Uniprot ID: Q9H082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV |
Gene Sequence | MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV |
Gene ID - Mouse | ENSMUSG00000027739 |
Gene ID - Rat | ENSRNOG00000013035 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RAB33B pAb (ATL-HPA048367) | |
Datasheet | Anti RAB33B pAb (ATL-HPA048367) Datasheet (External Link) |
Vendor Page | Anti RAB33B pAb (ATL-HPA048367) at Atlas Antibodies |
Documents & Links for Anti RAB33B pAb (ATL-HPA048367) | |
Datasheet | Anti RAB33B pAb (ATL-HPA048367) Datasheet (External Link) |
Vendor Page | Anti RAB33B pAb (ATL-HPA048367) |