Anti RAB20 pAb (ATL-HPA052111)

Atlas Antibodies

SKU:
ATL-HPA052111-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RAB20, member RAS oncogene family
Gene Name: RAB20
Alternative Gene Name: FLJ20429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031504: 96%, ENSRNOG00000023991: 98%
Entrez Gene ID: 55647
Uniprot ID: Q9NX57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCR
Gene Sequence LLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCR
Gene ID - Mouse ENSMUSG00000031504
Gene ID - Rat ENSRNOG00000023991
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RAB20 pAb (ATL-HPA052111)
Datasheet Anti RAB20 pAb (ATL-HPA052111) Datasheet (External Link)
Vendor Page Anti RAB20 pAb (ATL-HPA052111) at Atlas Antibodies

Documents & Links for Anti RAB20 pAb (ATL-HPA052111)
Datasheet Anti RAB20 pAb (ATL-HPA052111) Datasheet (External Link)
Vendor Page Anti RAB20 pAb (ATL-HPA052111)