Anti QTRT1 pAb (ATL-HPA049440 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049440-25

• 
• 

Protein Description: queuine tRNA-ribosyltransferase 1
Gene Name: QTRT1
Alternative Gene Name: TGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002825: 79%, ENSRNOG00000007158: 76%
Entrez Gene ID: 81890
Uniprot ID: Q9BXR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRDFMGAMYGDPTLCPTWA
• Gene Sequence: LRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRDFMGAMYGDPTLCPTWA
• Gene ID - Mouse: ENSMUSG00000002825
• Gene ID - Rat: ENSRNOG00000007158
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.