Anti QTRT1 pAb (ATL-HPA048651)

Atlas Antibodies

Catalog No.:
ATL-HPA048651-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: queuine tRNA-ribosyltransferase 1
Gene Name: QTRT1
Alternative Gene Name: TGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002825: 94%, ENSRNOG00000007158: 94%
Entrez Gene ID: 81890
Uniprot ID: Q9BXR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCLEEMTKRDVPGFAIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQ
Gene Sequence TCLEEMTKRDVPGFAIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQ
Gene ID - Mouse ENSMUSG00000002825
Gene ID - Rat ENSRNOG00000007158
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti QTRT1 pAb (ATL-HPA048651)
Datasheet Anti QTRT1 pAb (ATL-HPA048651) Datasheet (External Link)
Vendor Page Anti QTRT1 pAb (ATL-HPA048651) at Atlas Antibodies

Documents & Links for Anti QTRT1 pAb (ATL-HPA048651)
Datasheet Anti QTRT1 pAb (ATL-HPA048651) Datasheet (External Link)
Vendor Page Anti QTRT1 pAb (ATL-HPA048651)