Anti QTRT1 pAb (ATL-HPA048651)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048651-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: QTRT1
Alternative Gene Name: TGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002825: 94%, ENSRNOG00000007158: 94%
Entrez Gene ID: 81890
Uniprot ID: Q9BXR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TCLEEMTKRDVPGFAIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQ |
Gene Sequence | TCLEEMTKRDVPGFAIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQ |
Gene ID - Mouse | ENSMUSG00000002825 |
Gene ID - Rat | ENSRNOG00000007158 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti QTRT1 pAb (ATL-HPA048651) | |
Datasheet | Anti QTRT1 pAb (ATL-HPA048651) Datasheet (External Link) |
Vendor Page | Anti QTRT1 pAb (ATL-HPA048651) at Atlas Antibodies |
Documents & Links for Anti QTRT1 pAb (ATL-HPA048651) | |
Datasheet | Anti QTRT1 pAb (ATL-HPA048651) Datasheet (External Link) |
Vendor Page | Anti QTRT1 pAb (ATL-HPA048651) |