Anti QSOX1 pAb (ATL-HPA056243)

Atlas Antibodies

SKU: ATL-HPA056243-25

• 
• 

Protein Description: quiescin Q6 sulfhydryl oxidase 1
Gene Name: QSOX1
Alternative Gene Name: QSCN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033684: 58%, ENSRNOG00000003649: 59%
Entrez Gene ID: 5768
Uniprot ID: O00391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAAAPELAMGALELESRNSTLDP
• Gene Sequence: CSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAAAPELAMGALELESRNSTLDP
• Gene ID - Mouse: ENSMUSG00000033684
• Gene ID - Rat: ENSRNOG00000003649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.