Anti QRICH2 pAb (ATL-HPA052219 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052219-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using Anti-QRICH2 antibody. Corresponding QRICH2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear membrane & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutamine rich 2
Gene Name: QRICH2
Alternative Gene Name: DKFZP434P0316
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102439: 30%, ENSRNOG00000060603: 28%
Entrez Gene ID: 84074
Uniprot ID: Q9H0J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TAHPSDGVSSREQSKVPSGTGRQQQPRARDEAGVPRLHQSSTFQFKSDSDRHRSREKLTSTQPRRNARPGPVQQDLPLARDQPSSVPASQSQVHLR
Gene Sequence TAHPSDGVSSREQSKVPSGTGRQQQPRARDEAGVPRLHQSSTFQFKSDSDRHRSREKLTSTQPRRNARPGPVQQDLPLARDQPSSVPASQSQVHLR
Gene ID - Mouse ENSMUSG00000102439
Gene ID - Rat ENSRNOG00000060603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti QRICH2 pAb (ATL-HPA052219 w/enhanced validation)
Datasheet Anti QRICH2 pAb (ATL-HPA052219 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti QRICH2 pAb (ATL-HPA052219 w/enhanced validation)



Citations for Anti QRICH2 pAb (ATL-HPA052219 w/enhanced validation) – 1 Found
Shen, Ying; Zhang, Feng; Li, Fuping; Jiang, Xiaohui; Yang, Yihong; Li, Xiaoliang; Li, Weiyu; Wang, Xiang; Cheng, Juan; Liu, Mohan; Zhang, Xueguang; Yuan, Guiping; Pei, Xue; Cai, Kailai; Hu, Fengyun; Sun, Jianfeng; Yan, Lanzhen; Tang, Li; Jiang, Chuan; Tu, Wenling; Xu, Jinyan; Wu, Haojuan; Kong, Weiqi; Li, Shuying; Wang, Ke; Sheng, Kai; Zhao, Xudong; Yue, Huanxun; Yang, Xiaoyu; Xu, Wenming. Loss-of-function mutations in QRICH2 cause male infertility with multiple morphological abnormalities of the sperm flagella. Nature Communications. 2019;10(1):433.  PubMed