Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051224-25
  • Immunohistochemistry analysis in human tonsil and liver tissues using HPA051224 antibody. Corresponding PYHIN1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pyrin and HIN domain family, member 1
Gene Name: PYHIN1
Alternative Gene Name: IFIX, MGC23885
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054203: 33%, ENSRNOG00000019875: 30%
Entrez Gene ID: 149628
Uniprot ID: Q6K0P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCS
Gene Sequence IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCS
Gene ID - Mouse ENSMUSG00000054203
Gene ID - Rat ENSRNOG00000019875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation)
Datasheet Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation)
Datasheet Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation)



Citations for Anti PYHIN1 pAb (ATL-HPA051224 w/enhanced validation) – 1 Found
Ding, Jian-Ming; Lin, Wen-Rong; Fei, Zhao-Dong; Chen, Chuan-Ben. PYHIN1 correlates with CD8+ T cells infiltration and confers good patient survival in oral cancer. Journal Of Dental Sciences. 2022;17(1):551-559.  PubMed
!