Anti PYCR3 pAb (ATL-HPA053776)

Atlas Antibodies

SKU:
ATL-HPA053776-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to cytosol, cytokinetic bridge & mitotic spindle.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pyrroline-5-carboxylate reductase 3
Gene Name: PYCR3
Alternative Gene Name: FLJ13852, PYCRL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022571: 73%, ENSRNOG00000054724: 75%
Entrez Gene ID: 65263
Uniprot ID: Q53H96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVRGNKMAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPA
Gene Sequence GVRGNKMAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPA
Gene ID - Mouse ENSMUSG00000022571
Gene ID - Rat ENSRNOG00000054724
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PYCR3 pAb (ATL-HPA053776)
Datasheet Anti PYCR3 pAb (ATL-HPA053776) Datasheet (External Link)
Vendor Page Anti PYCR3 pAb (ATL-HPA053776) at Atlas Antibodies

Documents & Links for Anti PYCR3 pAb (ATL-HPA053776)
Datasheet Anti PYCR3 pAb (ATL-HPA053776) Datasheet (External Link)
Vendor Page Anti PYCR3 pAb (ATL-HPA053776)