Anti PYCARD pAb (ATL-HPA049074 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049074-100

• 
• 
• 

Protein Description: PYD and CARD domain containing
Gene Name: PYCARD
Alternative Gene Name: ASC, CARD5, TMS-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030793: 71%, ENSRNOG00000019675: 75%
Entrez Gene ID: 29108
Uniprot ID: Q9ULZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
• Gene Sequence: ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
• Gene ID - Mouse: ENSMUSG00000030793
• Gene ID - Rat: ENSRNOG00000019675
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.