Anti PXN pAb (ATL-HPA051309)

Atlas Antibodies

SKU: ATL-HPA051309-25

• 
• 

Protein Description: paxillin
Gene Name: PXN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029528: 83%, ENSRNOG00000001149: 84%
Entrez Gene ID: 5829
Uniprot ID: P49023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALNGTILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSL
• Gene Sequence: ALNGTILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSL
• Gene ID - Mouse: ENSMUSG00000029528
• Gene ID - Rat: ENSRNOG00000001149
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PXN pAb (ATL-HPA051309) – 2 Found

Baaske, Julia; Mühlhäuser, Wignand W D; Yousefi, O Sascha; Zanner, Sebastian; Radziwill, Gerald; Hörner, Maximilian; Schamel, Wolfgang W A; Weber, Wilfried. Optogenetic control of integrin-matrix interaction. Communications Biology. 2( 30652127):15. 

Camillo, Chiara; Facchinello, Nicola; Villari, Giulia; Mana, Giulia; Gioelli, Noemi; Sandri, Chiara; Astone, Matteo; Tortarolo, Dora; Clapero, Fabiana; Gays, Dafne; Oberkersch, Roxana E; Arese, Marco; Tamagnone, Luca; Valdembri, Donatella; Santoro, Massimo M; Serini, Guido. LPHN2 inhibits vascular permeability by differential control of endothelial cell adhesion. The Journal Of Cell Biology. 2021;220(11)