Protein Description: poliovirus receptor
Gene Name: PVR
Alternative Gene Name: CD155, HVED, Necl-5, NECL5, PVS, Tage4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062300: 54%, ENSRNOG00000018730: 53%
Entrez Gene ID: 5817
Uniprot ID: P15151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PVR
Alternative Gene Name: CD155, HVED, Necl-5, NECL5, PVS, Tage4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062300: 54%, ENSRNOG00000018730: 53%
Entrez Gene ID: 5817
Uniprot ID: P15151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILV |
| Documents & Links for Anti PVR pAb (ATL-HPA064739) | |
| Datasheet | Anti PVR pAb (ATL-HPA064739) Datasheet (External Link) |
| Vendor Page | Anti PVR pAb (ATL-HPA064739) at Atlas |
| Documents & Links for Anti PVR pAb (ATL-HPA064739) | |
| Datasheet | Anti PVR pAb (ATL-HPA064739) Datasheet (External Link) |
| Vendor Page | Anti PVR pAb (ATL-HPA064739) |