Anti PUS7L pAb (ATL-HPA058750)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058750-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PUS7L
Alternative Gene Name: DKFZP434G1415
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033356: 81%, ENSRNOG00000022570: 81%
Entrez Gene ID: 83448
Uniprot ID: Q9H0K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKR |
Gene Sequence | EYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKR |
Gene ID - Mouse | ENSMUSG00000033356 |
Gene ID - Rat | ENSRNOG00000022570 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PUS7L pAb (ATL-HPA058750) | |
Datasheet | Anti PUS7L pAb (ATL-HPA058750) Datasheet (External Link) |
Vendor Page | Anti PUS7L pAb (ATL-HPA058750) at Atlas Antibodies |
Documents & Links for Anti PUS7L pAb (ATL-HPA058750) | |
Datasheet | Anti PUS7L pAb (ATL-HPA058750) Datasheet (External Link) |
Vendor Page | Anti PUS7L pAb (ATL-HPA058750) |