Anti PUS7L pAb (ATL-HPA058750)

Atlas Antibodies

Catalog No.:
ATL-HPA058750-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pseudouridylate synthase 7 homolog (S. cerevisiae)-like
Gene Name: PUS7L
Alternative Gene Name: DKFZP434G1415
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033356: 81%, ENSRNOG00000022570: 81%
Entrez Gene ID: 83448
Uniprot ID: Q9H0K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKR
Gene Sequence EYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKR
Gene ID - Mouse ENSMUSG00000033356
Gene ID - Rat ENSRNOG00000022570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PUS7L pAb (ATL-HPA058750)
Datasheet Anti PUS7L pAb (ATL-HPA058750) Datasheet (External Link)
Vendor Page Anti PUS7L pAb (ATL-HPA058750) at Atlas Antibodies

Documents & Links for Anti PUS7L pAb (ATL-HPA058750)
Datasheet Anti PUS7L pAb (ATL-HPA058750) Datasheet (External Link)
Vendor Page Anti PUS7L pAb (ATL-HPA058750)