Anti PUS1 pAb (ATL-HPA051636)

Atlas Antibodies

SKU:
ATL-HPA051636-100
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: pseudouridylate synthase 1
Gene Name: PUS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029507: 95%, ENSRNOG00000037500: 95%
Entrez Gene ID: 80324
Uniprot ID: Q9Y606
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQDPSACRYILEMYCEEPFVREGLEFAVIRVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFG
Gene Sequence PQDPSACRYILEMYCEEPFVREGLEFAVIRVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFG
Gene ID - Mouse ENSMUSG00000029507
Gene ID - Rat ENSRNOG00000037500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PUS1 pAb (ATL-HPA051636)
Datasheet Anti PUS1 pAb (ATL-HPA051636) Datasheet (External Link)
Vendor Page Anti PUS1 pAb (ATL-HPA051636) at Atlas Antibodies

Documents & Links for Anti PUS1 pAb (ATL-HPA051636)
Datasheet Anti PUS1 pAb (ATL-HPA051636) Datasheet (External Link)
Vendor Page Anti PUS1 pAb (ATL-HPA051636)