Anti PURG pAb (ATL-HPA047746)

Atlas Antibodies

SKU: ATL-HPA047746-25

• 
• 

Protein Description: purine-rich element binding protein G
Gene Name: PURG
Alternative Gene Name: PURG-A, PURG-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049184: 90%, ENSRNOG00000015426: 92%
Entrez Gene ID: 29942
Uniprot ID: Q9UJV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
• Gene Sequence: RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
• Gene ID - Mouse: ENSMUSG00000049184
• Gene ID - Rat: ENSRNOG00000015426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.