Protein Description: pentraxin 4
Gene Name: PTX4
Alternative Gene Name: C16orf38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044172: 79%, ENSRNOG00000060934: 77%
Entrez Gene ID: 390667
Uniprot ID: Q96A99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTX4
Alternative Gene Name: C16orf38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044172: 79%, ENSRNOG00000060934: 77%
Entrez Gene ID: 390667
Uniprot ID: Q96A99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GGFDSSEAFVGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQGANCTCLERC |
| Documents & Links for Anti PTX4 pAb (ATL-HPA073694) | |
| Datasheet | Anti PTX4 pAb (ATL-HPA073694) Datasheet (External Link) |
| Vendor Page | Anti PTX4 pAb (ATL-HPA073694) at Atlas |
| Documents & Links for Anti PTX4 pAb (ATL-HPA073694) | |
| Datasheet | Anti PTX4 pAb (ATL-HPA073694) Datasheet (External Link) |
| Vendor Page | Anti PTX4 pAb (ATL-HPA073694) |