Anti PTTG1 pAb (ATL-HPA045034)

Atlas Antibodies

SKU: ATL-HPA045034-25

• 
• 

Protein Description: pituitary tumor-transforming 1
Gene Name: PTTG1
Alternative Gene Name: EAP1, HPTTG, PTTG, securin, TUTR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020415: 60%, ENSRNOG00000003802: 67%
Entrez Gene ID: 9232
Uniprot ID: O95997
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA
• Gene Sequence: LPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA
• Gene ID - Mouse: ENSMUSG00000020415
• Gene ID - Rat: ENSRNOG00000003802
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.