Protein Description: protein tyrosine phosphatase, receptor type, R
Gene Name: PTPRR
Alternative Gene Name: EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020151: 80%, ENSRNOG00000004483: 80%
Entrez Gene ID: 5801
Uniprot ID: Q15256
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTPRR
Alternative Gene Name: EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020151: 80%, ENSRNOG00000004483: 80%
Entrez Gene ID: 5801
Uniprot ID: Q15256
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFK |
Documents & Links for Anti PTPRR pAb (ATL-HPA071067) | |
Datasheet | Anti PTPRR pAb (ATL-HPA071067) Datasheet (External Link) |
Vendor Page | Anti PTPRR pAb (ATL-HPA071067) at Atlas |
Documents & Links for Anti PTPRR pAb (ATL-HPA071067) | |
Datasheet | Anti PTPRR pAb (ATL-HPA071067) Datasheet (External Link) |
Vendor Page | Anti PTPRR pAb (ATL-HPA071067) |