Protein Description: protein tyrosine phosphatase, receptor type, O
Gene Name: PTPRO
Alternative Gene Name: GLEPP1, NPHS6, PTP-oc, PTP-U2, PTPU2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030223: 83%, ENSRNOG00000006231: 84%
Entrez Gene ID: 5800
Uniprot ID: Q16827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTPRO
Alternative Gene Name: GLEPP1, NPHS6, PTP-oc, PTP-U2, PTPU2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030223: 83%, ENSRNOG00000006231: 84%
Entrez Gene ID: 5800
Uniprot ID: Q16827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP |
| Documents & Links for Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) | |
| Datasheet | Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) at Atlas |
| Documents & Links for Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) | |
| Datasheet | Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) |
| Citations for Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) – 3 Found |
| Bockmeyer, Clemens L; Wittig, Juliane; Säuberlich, Karen; Selhausen, Philipp; Eßer, Marc; Zeuschner, Philip; Modde, Friedrich; Amann, Kerstin; Daniel, Christoph. Recommendations for mRNA analysis of micro-dissected glomerular tufts from paraffin-embedded human kidney biopsy samples. Bmc Molecular Biology. 2018;19(1):2. PubMed |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Zhang, Wenjie; Hou, Jiajie; Wang, Xiaochen; Jiang, Runqiu; Yin, Yin; Ji, Jie; Deng, Lei; Huang, Xingxu; Wang, Ke; Sun, Beicheng. PTPRO-mediated autophagy prevents hepatosteatosis and tumorigenesis. Oncotarget. 2015;6(11):9420-33. PubMed |