Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA034525-25
  • Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, receptor type, O
Gene Name: PTPRO
Alternative Gene Name: GLEPP1, NPHS6, PTP-oc, PTP-U2, PTPU2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030223: 83%, ENSRNOG00000006231: 84%
Entrez Gene ID: 5800
Uniprot ID: Q16827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP
Gene Sequence TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP
Gene ID - Mouse ENSMUSG00000030223
Gene ID - Rat ENSRNOG00000006231
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation)
Datasheet Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation)
Datasheet Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation)



Citations for Anti PTPRO pAb (ATL-HPA034525 w/enhanced validation) – 3 Found
Bockmeyer, Clemens L; Wittig, Juliane; Säuberlich, Karen; Selhausen, Philipp; Eßer, Marc; Zeuschner, Philip; Modde, Friedrich; Amann, Kerstin; Daniel, Christoph. Recommendations for mRNA analysis of micro-dissected glomerular tufts from paraffin-embedded human kidney biopsy samples. Bmc Molecular Biology. 2018;19(1):2.  PubMed
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Zhang, Wenjie; Hou, Jiajie; Wang, Xiaochen; Jiang, Runqiu; Yin, Yin; Ji, Jie; Deng, Lei; Huang, Xingxu; Wang, Ke; Sun, Beicheng. PTPRO-mediated autophagy prevents hepatosteatosis and tumorigenesis. Oncotarget. 2015;6(11):9420-33.  PubMed