Anti PTPRK pAb (ATL-HPA054822)

Atlas Antibodies

SKU:
ATL-HPA054822-25
  • Immunohistochemical staining of human cerebral cortex shows moderate positivity in a subset of neural fibers.
  • Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane & cell junctions.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, receptor type, K
Gene Name: PTPRK
Alternative Gene Name: R-PTP-kappa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019889: 98%, ENSRNOG00000047605: 98%
Entrez Gene ID: 5796
Uniprot ID: Q15262
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE
Gene Sequence MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE
Gene ID - Mouse ENSMUSG00000019889
Gene ID - Rat ENSRNOG00000047605
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PTPRK pAb (ATL-HPA054822)
Datasheet Anti PTPRK pAb (ATL-HPA054822) Datasheet (External Link)
Vendor Page Anti PTPRK pAb (ATL-HPA054822) at Atlas Antibodies

Documents & Links for Anti PTPRK pAb (ATL-HPA054822)
Datasheet Anti PTPRK pAb (ATL-HPA054822) Datasheet (External Link)
Vendor Page Anti PTPRK pAb (ATL-HPA054822)



Citations for Anti PTPRK pAb (ATL-HPA054822) – 1 Found
Matsushita, Masashi; Mori, Yusuke; Uchiumi, Kyosuke; Ogata, Takehiro; Nakamura, Mizuyo; Yoda, Hiroyuki; Soda, Hiroaki; Takiguchi, Nobuhiro; Nabeya, Yoshihiro; Shimozato, Osamu; Ozaki, Toshinori. PTPRK suppresses progression and chemo-resistance of colon cancer cells via direct inhibition of pro-oncogenic CD133. Febs Open Bio. 2019;9(5):935-946.  PubMed