Anti PTPRK pAb (ATL-HPA054822)
Atlas Antibodies
- SKU:
- ATL-HPA054822-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PTPRK
Alternative Gene Name: R-PTP-kappa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019889: 98%, ENSRNOG00000047605: 98%
Entrez Gene ID: 5796
Uniprot ID: Q15262
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE |
Gene Sequence | MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE |
Gene ID - Mouse | ENSMUSG00000019889 |
Gene ID - Rat | ENSRNOG00000047605 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PTPRK pAb (ATL-HPA054822) | |
Datasheet | Anti PTPRK pAb (ATL-HPA054822) Datasheet (External Link) |
Vendor Page | Anti PTPRK pAb (ATL-HPA054822) at Atlas Antibodies |
Documents & Links for Anti PTPRK pAb (ATL-HPA054822) | |
Datasheet | Anti PTPRK pAb (ATL-HPA054822) Datasheet (External Link) |
Vendor Page | Anti PTPRK pAb (ATL-HPA054822) |
Citations for Anti PTPRK pAb (ATL-HPA054822) – 1 Found |
Matsushita, Masashi; Mori, Yusuke; Uchiumi, Kyosuke; Ogata, Takehiro; Nakamura, Mizuyo; Yoda, Hiroyuki; Soda, Hiroaki; Takiguchi, Nobuhiro; Nabeya, Yoshihiro; Shimozato, Osamu; Ozaki, Toshinori. PTPRK suppresses progression and chemo-resistance of colon cancer cells via direct inhibition of pro-oncogenic CD133. Febs Open Bio. 2019;9(5):935-946. PubMed |