Anti PTPRD pAb (ATL-HPA054829)

Atlas Antibodies

SKU: ATL-HPA054829-25

• 
• 

Protein Description: protein tyrosine phosphatase, receptor type, D
Gene Name: PTPRD
Alternative Gene Name: HPTP, PTPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028399: 99%, ENSRNOG00000005711: 99%
Entrez Gene ID: 5789
Uniprot ID: P23468
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE
• Gene Sequence: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE
• Gene ID - Mouse: ENSMUSG00000028399
• Gene ID - Rat: ENSRNOG00000005711
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.