Anti PTPN3 pAb (ATL-HPA046728)

Atlas Antibodies

SKU: ATL-HPA046728-25

• 

Protein Description: protein tyrosine phosphatase, non-receptor type 3
Gene Name: PTPN3
Alternative Gene Name: PTPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038764: 85%, ENSRNOG00000011425: 85%
Entrez Gene ID: 5774
Uniprot ID: P26045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFE
• Gene Sequence: FIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFE
• Gene ID - Mouse: ENSMUSG00000038764
• Gene ID - Rat: ENSRNOG00000011425
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.