Anti PTPN18 pAb (ATL-HPA053367)

Atlas Antibodies

SKU:
ATL-HPA053367-25
  • Immunofluorescent staining of human cell line HeLa shows localization to intermediate filaments.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, non-receptor type 18
Gene Name: PTPN18
Alternative Gene Name: BDP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026126: 68%, ENSRNOG00000013415: 65%
Entrez Gene ID: 26469
Uniprot ID: Q99952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK
Gene Sequence EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK
Gene ID - Mouse ENSMUSG00000026126
Gene ID - Rat ENSRNOG00000013415
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PTPN18 pAb (ATL-HPA053367)
Datasheet Anti PTPN18 pAb (ATL-HPA053367) Datasheet (External Link)
Vendor Page Anti PTPN18 pAb (ATL-HPA053367) at Atlas Antibodies

Documents & Links for Anti PTPN18 pAb (ATL-HPA053367)
Datasheet Anti PTPN18 pAb (ATL-HPA053367) Datasheet (External Link)
Vendor Page Anti PTPN18 pAb (ATL-HPA053367)