Protein Description: prostate tumor overexpressed 1
Gene Name: PTOV1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038502: 100%, ENSRNOG00000020358: 100%
Entrez Gene ID: 53635
Uniprot ID: Q86YD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTOV1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038502: 100%, ENSRNOG00000020358: 100%
Entrez Gene ID: 53635
Uniprot ID: Q86YD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRT |
| Documents & Links for Anti PTOV1 pAb (ATL-HPA075125) | |
| Datasheet | Anti PTOV1 pAb (ATL-HPA075125) Datasheet (External Link) |
| Vendor Page | Anti PTOV1 pAb (ATL-HPA075125) at Atlas |
| Documents & Links for Anti PTOV1 pAb (ATL-HPA075125) | |
| Datasheet | Anti PTOV1 pAb (ATL-HPA075125) Datasheet (External Link) |
| Vendor Page | Anti PTOV1 pAb (ATL-HPA075125) |