Anti PTBP3 pAb (ATL-HPA048374)

Atlas Antibodies

SKU: ATL-HPA048374-25

• 

Protein Description: polypyrimidine tract binding protein 3
Gene Name: PTBP3
Alternative Gene Name: DKFZp781I1117, ROD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028382: 89%, ENSRNOG00000016334: 89%
Entrez Gene ID: 9991
Uniprot ID: O95758
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGN
• Gene Sequence: PAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGN
• Gene ID - Mouse: ENSMUSG00000028382
• Gene ID - Rat: ENSRNOG00000016334
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.