Anti PTBP2 pAb (ATL-HPA047420)

Atlas Antibodies

SKU: ATL-HPA047420-25

• 
• 

Protein Description: polypyrimidine tract binding protein 2
Gene Name: PTBP2
Alternative Gene Name: brPTB, nPTB, PTB, PTBLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028134: 100%, ENSRNOG00000010827: 100%
Entrez Gene ID: 58155
Uniprot ID: Q9UKA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQPALDPAIAAAFAKETSLLAVPGALSPLAI
• Gene Sequence: GQPALDPAIAAAFAKETSLLAVPGALSPLAI
• Gene ID - Mouse: ENSMUSG00000028134
• Gene ID - Rat: ENSRNOG00000010827
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.