Anti PSMG2 pAb (ATL-HPA046741)

Atlas Antibodies

SKU: ATL-HPA046741-25

• 
• 

Protein Description: proteasome (prosome, macropain) assembly chaperone 2
Gene Name: PSMG2
Alternative Gene Name: CLAST3, HCCA3, HsT1707, MDS003, MGC15092, PAC2, TNFSF5IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024537: 88%, ENSRNOG00000017729: 85%
Entrez Gene ID: 56984
Uniprot ID: Q969U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLP
• Gene Sequence: IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLP
• Gene ID - Mouse: ENSMUSG00000024537
• Gene ID - Rat: ENSRNOG00000017729
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.