Anti PSME4 pAb (ATL-HPA060922)

Atlas Antibodies

SKU: ATL-HPA060922-25

• 
• 
• 

Protein Description: proteasome (prosome, macropain) activator subunit 4
Gene Name: PSME4
Alternative Gene Name: KIAA0077, PA200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040850: 97%, ENSRNOG00000060340: 97%
Entrez Gene ID: 23198
Uniprot ID: Q14997
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTQQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPAIVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQYETIGLDFTIPKSCVEIAELLQQSK
• Gene Sequence: VTQQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPAIVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQYETIGLDFTIPKSCVEIAELLQQSK
• Gene ID - Mouse: ENSMUSG00000040850
• Gene ID - Rat: ENSRNOG00000060340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.