Anti PSMC2 pAb (ATL-HPA049621)

Atlas Antibodies

SKU: ATL-HPA049621-25

• 
• 

Protein Description: proteasome 26S subunit, ATPase 2
Gene Name: PSMC2
Alternative Gene Name: MSS1, Nbla10058, S7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028932: 100%, ENSRNOG00000012026: 100%
Entrez Gene ID: 5701
Uniprot ID: P35998
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV
• Gene Sequence: KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV
• Gene ID - Mouse: ENSMUSG00000028932
• Gene ID - Rat: ENSRNOG00000012026
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.