Anti PSMB9 pAb (ATL-HPA053280 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053280-100

• 
• 

Protein Description: proteasome (prosome, macropain) subunit, beta type, 9
Gene Name: PSMB9
Alternative Gene Name: beta1i, LMP2, PSMB6i, RING12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096727: 87%, ENSRNOG00000000459: 92%
Entrez Gene ID: 5698
Uniprot ID: P28065
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGS
• Gene Sequence: GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGS
• Gene ID - Mouse: ENSMUSG00000096727
• Gene ID - Rat: ENSRNOG00000000459
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.