Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA046995-100
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/93850/170776/atl-hpa046995_anti-psmb8-pab-atl-hpa046995-wenhanced-validation_52428__39621.1681124522.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: PSMB8
Alternative Gene Name: beta5i, D6S216E, LMP7, PSMB5i, RING10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024338: 82%, ENSRNOG00000000456: 88%
Entrez Gene ID: 5696
Uniprot ID: P28062
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
| Gene Sequence | GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
| Gene ID - Mouse | ENSMUSG00000024338 |
| Gene ID - Rat | ENSRNOG00000000456 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) | |
| Datasheet | Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) | |
| Datasheet | Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) |
| Citations for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) – 1 Found |
| Liew, Phui-Ly; Huang, Rui-Lan; Weng, Yu-Chun; Fang, Chia-Lang; Hui-Ming Huang, Tim; Lai, Hung-Cheng. Distinct methylation profile of mucinous ovarian carcinoma reveals susceptibility to proteasome inhibitors. International Journal Of Cancer. 2018;143(2):355-367. PubMed |