Anti PSMB7 pAb (ATL-HPA054902)
Atlas Antibodies
- SKU:
- ATL-HPA054902-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PSMB7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026750: 95%, ENSRNOG00000011732: 92%
Entrez Gene ID: 5695
Uniprot ID: Q99436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM |
Gene Sequence | LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM |
Gene ID - Mouse | ENSMUSG00000026750 |
Gene ID - Rat | ENSRNOG00000011732 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSMB7 pAb (ATL-HPA054902) | |
Datasheet | Anti PSMB7 pAb (ATL-HPA054902) Datasheet (External Link) |
Vendor Page | Anti PSMB7 pAb (ATL-HPA054902) at Atlas Antibodies |
Documents & Links for Anti PSMB7 pAb (ATL-HPA054902) | |
Datasheet | Anti PSMB7 pAb (ATL-HPA054902) Datasheet (External Link) |
Vendor Page | Anti PSMB7 pAb (ATL-HPA054902) |