Anti PSMB7 pAb (ATL-HPA052408)
Atlas Antibodies
- SKU:
- ATL-HPA052408-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PSMB7
Alternative Gene Name: Z
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026750: 100%, ENSRNOG00000011732: 100%
Entrez Gene ID: 5695
Uniprot ID: Q99436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA |
| Gene Sequence | RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA |
| Gene ID - Mouse | ENSMUSG00000026750 |
| Gene ID - Rat | ENSRNOG00000011732 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSMB7 pAb (ATL-HPA052408) | |
| Datasheet | Anti PSMB7 pAb (ATL-HPA052408) Datasheet (External Link) |
| Vendor Page | Anti PSMB7 pAb (ATL-HPA052408) at Atlas Antibodies |
| Documents & Links for Anti PSMB7 pAb (ATL-HPA052408) | |
| Datasheet | Anti PSMB7 pAb (ATL-HPA052408) Datasheet (External Link) |
| Vendor Page | Anti PSMB7 pAb (ATL-HPA052408) |
| Citations for Anti PSMB7 pAb (ATL-HPA052408) – 1 Found |
| Koehler, Sybille; Kuczkowski, Alexander; Kuehne, Lucas; Jüngst, Christian; Hoehne, Martin; Grahammer, Florian; Eddy, Sean; Kretzler, Matthias; Beck, Bodo B; Höhfeld, Jörg; Schermer, Bernhard; Benzing, Thomas; Brinkkoetter, Paul T; Rinschen, Markus M. Proteome Analysis of Isolated Podocytes Reveals Stress Responses in Glomerular Sclerosis. Journal Of The American Society Of Nephrology : Jasn. 2020;31(3):544-559. PubMed |