Anti PSMB5 pAb (ATL-HPA061796)

Atlas Antibodies

SKU:
ATL-HPA061796-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & centrosome.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: proteasome subunit beta 5
Gene Name: PSMB5
Alternative Gene Name: MB1, X
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022193: 86%, ENSRNOG00000013386: 88%
Entrez Gene ID: 5693
Uniprot ID: P28074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Gene Sequence LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Gene ID - Mouse ENSMUSG00000022193
Gene ID - Rat ENSRNOG00000013386
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PSMB5 pAb (ATL-HPA061796)
Datasheet Anti PSMB5 pAb (ATL-HPA061796) Datasheet (External Link)
Vendor Page Anti PSMB5 pAb (ATL-HPA061796) at Atlas Antibodies

Documents & Links for Anti PSMB5 pAb (ATL-HPA061796)
Datasheet Anti PSMB5 pAb (ATL-HPA061796) Datasheet (External Link)
Vendor Page Anti PSMB5 pAb (ATL-HPA061796)