Anti PSMB11 pAb (ATL-HPA056970 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056970-25
  • Immunohistochemical staining of human colon, kidney, lymph node and thymus using Anti-PSMB11 antibody HPA056970 (A) shows similar protein distribution across tissues to independent antibody HPA028967 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) subunit, beta type, 11
Gene Name: PSMB11
Alternative Gene Name: beta5t
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072423: 63%, ENSRNOG00000047091: 62%
Entrez Gene ID: 122706
Uniprot ID: A5LHX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTET
Gene Sequence GSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTET
Gene ID - Mouse ENSMUSG00000072423
Gene ID - Rat ENSRNOG00000047091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PSMB11 pAb (ATL-HPA056970 w/enhanced validation)
Datasheet Anti PSMB11 pAb (ATL-HPA056970 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMB11 pAb (ATL-HPA056970 w/enhanced validation)