Anti PSMA4 pAb (ATL-HPA055466)

Atlas Antibodies

SKU: ATL-HPA055466-25

• 
• 
• 

Protein Description: proteasome (prosome, macropain) subunit, alpha type, 4
Gene Name: PSMA4
Alternative Gene Name: HC9, HsT17706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032301: 100%, ENSRNOG00000013493: 100%
Entrez Gene ID: 5685
Uniprot ID: P25789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
• Gene Sequence: MEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
• Gene ID - Mouse: ENSMUSG00000032301
• Gene ID - Rat: ENSRNOG00000013493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.