Anti PSEN1 pAb (ATL-HPA067496)
Atlas Antibodies
- SKU:
- ATL-HPA067496-25
- Shipping:
- Calculated at Checkout
$328.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Product Description
Protein Description: presenilin 1
Gene Name: PSEN1
Alternative Gene Name: AD3, FAD, PS1, S182
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019969: 74%, ENSRNOG00000009110: 73%
Entrez Gene ID: 5663
Uniprot ID: P49768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSEN1
Alternative Gene Name: AD3, FAD, PS1, S182
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019969: 74%, ENSRNOG00000009110: 73%
Entrez Gene ID: 5663
Uniprot ID: P49768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ |
| Gene Sequence | MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ |
| Gene ID - Mouse | ENSMUSG00000019969 |
| Gene ID - Rat | ENSRNOG00000009110 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti PSEN1 pAb (ATL-HPA067496) | |
| Datasheet | Anti PSEN1 pAb (ATL-HPA067496) Datasheet (External Link) |
| Vendor Page | Anti PSEN1 pAb (ATL-HPA067496) at Atlas Antibodies |
| Documents & Links for Anti PSEN1 pAb (ATL-HPA067496) | |
| Datasheet | Anti PSEN1 pAb (ATL-HPA067496) Datasheet (External Link) |
| Vendor Page | Anti PSEN1 pAb (ATL-HPA067496) |