Anti PSEN1 pAb (ATL-HPA067496)

Catalog No:
ATL-HPA067496-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: presenilin 1
Gene Name: PSEN1
Alternative Gene Name: AD3, FAD, PS1, S182
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019969: 74%, ENSRNOG00000009110: 73%
Entrez Gene ID: 5663
Uniprot ID: P49768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ

Documents & Links for Anti PSEN1 pAb (ATL-HPA067496)
Datasheet Anti PSEN1 pAb (ATL-HPA067496) Datasheet (External Link)
Vendor Page Anti PSEN1 pAb (ATL-HPA067496) at Atlas

Documents & Links for Anti PSEN1 pAb (ATL-HPA067496)
Datasheet Anti PSEN1 pAb (ATL-HPA067496) Datasheet (External Link)
Vendor Page Anti PSEN1 pAb (ATL-HPA067496)