Protein Description: presenilin 1
Gene Name: PSEN1
Alternative Gene Name: AD3, FAD, PS1, S182
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019969: 74%, ENSRNOG00000009110: 73%
Entrez Gene ID: 5663
Uniprot ID: P49768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSEN1
Alternative Gene Name: AD3, FAD, PS1, S182
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019969: 74%, ENSRNOG00000009110: 73%
Entrez Gene ID: 5663
Uniprot ID: P49768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ |
Documents & Links for Anti PSEN1 pAb (ATL-HPA067496) | |
Datasheet | Anti PSEN1 pAb (ATL-HPA067496) Datasheet (External Link) |
Vendor Page | Anti PSEN1 pAb (ATL-HPA067496) at Atlas |
Documents & Links for Anti PSEN1 pAb (ATL-HPA067496) | |
Datasheet | Anti PSEN1 pAb (ATL-HPA067496) Datasheet (External Link) |
Vendor Page | Anti PSEN1 pAb (ATL-HPA067496) |