Anti PSD4 pAb (ATL-HPA077847)

Catalog No:
ATL-HPA077847-25
$447.00
Protein Description: pleckstrin and Sec7 domain containing 4
Gene Name: PSD4
Alternative Gene Name: EFA6B, TIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026979: 31%, ENSRNOG00000006079: 31%
Entrez Gene ID: 23550
Uniprot ID: Q8NDX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence HSSGILPKWTLDASQSSLLETDGEQPSSLKKKEAGEAPKPGEEVKSEGTARPAETGDVQPDIHLTSAEHENLRTPMNSSWLPG
Gene ID - Mouse ENSMUSG00000026979
Gene ID - Rat ENSMUSG00000026979
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti PSD4 pAb (ATL-HPA077847)
Datasheet Anti PSD4 pAb (ATL-HPA077847) Datasheet (External Link)
Vendor Page Anti PSD4 pAb (ATL-HPA077847) at Atlas

Documents & Links for Anti PSD4 pAb (ATL-HPA077847)
Datasheet Anti PSD4 pAb (ATL-HPA077847) Datasheet (External Link)
Vendor Page Anti PSD4 pAb (ATL-HPA077847)