Protein Description: pleckstrin and Sec7 domain containing 4
Gene Name: PSD4
Alternative Gene Name: EFA6B, TIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026979: 31%, ENSRNOG00000006079: 31%
Entrez Gene ID: 23550
Uniprot ID: Q8NDX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PSD4
Alternative Gene Name: EFA6B, TIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026979: 31%, ENSRNOG00000006079: 31%
Entrez Gene ID: 23550
Uniprot ID: Q8NDX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HSSGILPKWTLDASQSSLLETDGEQPSSLKKKEAGEAPKPGEEVKSEGTARPAETGDVQPDIHLTSAEHENLRTPMNSSWLPG |
Gene ID - Mouse | ENSMUSG00000026979 |
Gene ID - Rat | ENSMUSG00000026979 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSD4 pAb (ATL-HPA077847) | |
Datasheet | Anti PSD4 pAb (ATL-HPA077847) Datasheet (External Link) |
Vendor Page | Anti PSD4 pAb (ATL-HPA077847) at Atlas |
Documents & Links for Anti PSD4 pAb (ATL-HPA077847) | |
Datasheet | Anti PSD4 pAb (ATL-HPA077847) Datasheet (External Link) |
Vendor Page | Anti PSD4 pAb (ATL-HPA077847) |