Anti PSD pAb (ATL-HPA059237)

Atlas Antibodies

SKU: ATL-HPA059237-25

• 
• 

Protein Description: pleckstrin and Sec7 domain containing
Gene Name: PSD
Alternative Gene Name: KIAA2011, PSD1, TYL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037126: 85%, ENSRNOG00000019435: 83%
Entrez Gene ID: 5662
Uniprot ID: A5PKW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRLEASTSDPLPARGGSALPGSRNLVHGPPAPPQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKWE
• Gene Sequence: LRLEASTSDPLPARGGSALPGSRNLVHGPPAPPQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKWE
• Gene ID - Mouse: ENSMUSG00000037126
• Gene ID - Rat: ENSRNOG00000019435
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSD pAb (ATL-HPA059237) – 1 Found

Ghosh, Mallika; Lo, Robin; Ivic, Ivan; Aguilera, Brian; Qendro, Veneta; Devarakonda, Charan; Shapiro, Linda H. CD13 tethers the IQGAP1-ARF6-EFA6 complex to the plasma membrane to promote ARF6 activation, β1 integrin recycling, and cell migration. Science Signaling. 2019;12(579)