Anti PRSS38 pAb (ATL-HPA055809 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055809-100

• 
• 

Protein Description: protease, serine, 38
Gene Name: PRSS38
Alternative Gene Name: MPN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049291: 64%, ENSRNOG00000022548: 64%
Entrez Gene ID: 339501
Uniprot ID: A1L453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IYDMYVGLVNLRVAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATPE
• Gene Sequence: IYDMYVGLVNLRVAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATPE
• Gene ID - Mouse: ENSMUSG00000049291
• Gene ID - Rat: ENSRNOG00000022548
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.