Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA063471-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PRSS1
Alternative Gene Name: TRY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071519: 90%, ENSRNOG00000050119: 90%
Entrez Gene ID: 5644
Uniprot ID: P07477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RIQVRLGEHNIEVLEGNEQFINAAKIIRHP |
Gene Sequence | RIQVRLGEHNIEVLEGNEQFINAAKIIRHP |
Gene ID - Mouse | ENSMUSG00000071519 |
Gene ID - Rat | ENSRNOG00000050119 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) | |
Datasheet | Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) | |
Datasheet | Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) |