Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA063471-25
  • Immunohistochemistry analysis in human pancreas and cerebral cortex tissues using HPA063471 antibody. Corresponding PRSS1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: protease, serine, 1 (trypsin 1)
Gene Name: PRSS1
Alternative Gene Name: TRY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071519: 90%, ENSRNOG00000050119: 90%
Entrez Gene ID: 5644
Uniprot ID: P07477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIQVRLGEHNIEVLEGNEQFINAAKIIRHP
Gene Sequence RIQVRLGEHNIEVLEGNEQFINAAKIIRHP
Gene ID - Mouse ENSMUSG00000071519
Gene ID - Rat ENSRNOG00000050119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation)
Datasheet Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation)
Datasheet Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRSS1 pAb (ATL-HPA063471 w/enhanced validation)