Anti PRRT4 pAb (ATL-HPA046373)

Atlas Antibodies

SKU:
ATL-HPA046373-25
  • Immunohistochemical staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm, plasma membrane & peroxisomes.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: proline-rich transmembrane protein 4
Gene Name: PRRT4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079654: 82%, ENSRNOG00000039388: 81%
Entrez Gene ID: 401399
Uniprot ID: C9JH25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PATTLTPVPQSEASMLSLNLGLNFKFHLRGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGS
Gene Sequence PATTLTPVPQSEASMLSLNLGLNFKFHLRGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGS
Gene ID - Mouse ENSMUSG00000079654
Gene ID - Rat ENSRNOG00000039388
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRRT4 pAb (ATL-HPA046373)
Datasheet Anti PRRT4 pAb (ATL-HPA046373) Datasheet (External Link)
Vendor Page Anti PRRT4 pAb (ATL-HPA046373) at Atlas Antibodies

Documents & Links for Anti PRRT4 pAb (ATL-HPA046373)
Datasheet Anti PRRT4 pAb (ATL-HPA046373) Datasheet (External Link)
Vendor Page Anti PRRT4 pAb (ATL-HPA046373)