Protein Description: proline rich transmembrane protein 3
Gene Name: PRRT3
Alternative Gene Name: FLJ33674
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045009: 76%, ENSRNOG00000009863: 81%
Entrez Gene ID: 285368
Uniprot ID: Q5FWE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRRT3
Alternative Gene Name: FLJ33674
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045009: 76%, ENSRNOG00000009863: 81%
Entrez Gene ID: 285368
Uniprot ID: Q5FWE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PTEHACWAKLMRLACPAPSGKSEVPERPNNCYAGPSNVGAGSLDISKSLIRNPAESGQLATPSSGAWGSAASLGRGPQGGPGLSRNGV |
| Documents & Links for Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) | |
| Datasheet | Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) at Atlas |
| Documents & Links for Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) | |
| Datasheet | Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) |