Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA069859-25
  • Immunohistochemistry analysis in human cerebral cortex and duodenum tissues using Anti-PRRT3 antibody. Corresponding PRRT3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proline rich transmembrane protein 3
Gene Name: PRRT3
Alternative Gene Name: FLJ33674
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045009: 76%, ENSRNOG00000009863: 81%
Entrez Gene ID: 285368
Uniprot ID: Q5FWE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTEHACWAKLMRLACPAPSGKSEVPERPNNCYAGPSNVGAGSLDISKSLIRNPAESGQLATPSSGAWGSAASLGRGPQGGPGLSRNGV
Gene Sequence PTEHACWAKLMRLACPAPSGKSEVPERPNNCYAGPSNVGAGSLDISKSLIRNPAESGQLATPSSGAWGSAASLGRGPQGGPGLSRNGV
Gene ID - Mouse ENSMUSG00000045009
Gene ID - Rat ENSRNOG00000009863
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation)
Datasheet Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation)
Datasheet Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRRT3 pAb (ATL-HPA069859 w/enhanced validation)