Anti PRRT1 pAb (ATL-HPA055149)

Atlas Antibodies

SKU: ATL-HPA055149-25

• 
• 

Protein Description: proline-rich transmembrane protein 1
Gene Name: PRRT1
Alternative Gene Name: C6orf31, IFITMD7, NG5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015476: 95%, ENSRNOG00000000433: 94%
Entrez Gene ID: 80863
Uniprot ID: Q99946
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTL
• Gene Sequence: PAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTL
• Gene ID - Mouse: ENSMUSG00000015476
• Gene ID - Rat: ENSRNOG00000000433
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.