Anti PRRG3 pAb (ATL-HPA060566)
Atlas Antibodies
- SKU:
- ATL-HPA060566-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PRRG3
Alternative Gene Name: TMG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033361: 100%, ENSRNOG00000045663: 100%
Entrez Gene ID: 79057
Uniprot ID: Q9BZD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMY |
Gene Sequence | EVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMY |
Gene ID - Mouse | ENSMUSG00000033361 |
Gene ID - Rat | ENSRNOG00000045663 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRRG3 pAb (ATL-HPA060566) | |
Datasheet | Anti PRRG3 pAb (ATL-HPA060566) Datasheet (External Link) |
Vendor Page | Anti PRRG3 pAb (ATL-HPA060566) at Atlas Antibodies |
Documents & Links for Anti PRRG3 pAb (ATL-HPA060566) | |
Datasheet | Anti PRRG3 pAb (ATL-HPA060566) Datasheet (External Link) |
Vendor Page | Anti PRRG3 pAb (ATL-HPA060566) |