Protein Description: proline-rich coiled-coil 2B
Gene Name: PRRC2B
Alternative Gene Name: BAT2L, BAT2L1, KIAA0515, LQFBS-1, MGC10526
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039262: 86%, ENSRNOG00000010217: 87%
Entrez Gene ID: 84726
Uniprot ID: Q5JSZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PRRC2B
Alternative Gene Name: BAT2L, BAT2L1, KIAA0515, LQFBS-1, MGC10526
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039262: 86%, ENSRNOG00000010217: 87%
Entrez Gene ID: 84726
Uniprot ID: Q5JSZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSFSASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQELLFPPQENVQDAGAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQP |
| Documents & Links for Anti PRRC2B pAb (ATL-HPA064301) | |
| Datasheet | Anti PRRC2B pAb (ATL-HPA064301) Datasheet (External Link) |
| Vendor Page | Anti PRRC2B pAb (ATL-HPA064301) at Atlas |
| Documents & Links for Anti PRRC2B pAb (ATL-HPA064301) | |
| Datasheet | Anti PRRC2B pAb (ATL-HPA064301) Datasheet (External Link) |
| Vendor Page | Anti PRRC2B pAb (ATL-HPA064301) |