Anti PRRC2B pAb (ATL-HPA064301)

Atlas Antibodies

SKU:
ATL-HPA064301-25
  • Immunofluorescent staining of human cell line SiHa shows localization to nuclear bodies & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: proline-rich coiled-coil 2B
Gene Name: PRRC2B
Alternative Gene Name: BAT2L, BAT2L1, KIAA0515, LQFBS-1, MGC10526
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039262: 86%, ENSRNOG00000010217: 87%
Entrez Gene ID: 84726
Uniprot ID: Q5JSZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSFSASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQELLFPPQENVQDAGAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQP
Gene Sequence SSFSASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQELLFPPQENVQDAGAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQP
Gene ID - Mouse ENSMUSG00000039262
Gene ID - Rat ENSRNOG00000010217
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRRC2B pAb (ATL-HPA064301)
Datasheet Anti PRRC2B pAb (ATL-HPA064301) Datasheet (External Link)
Vendor Page Anti PRRC2B pAb (ATL-HPA064301) at Atlas Antibodies

Documents & Links for Anti PRRC2B pAb (ATL-HPA064301)
Datasheet Anti PRRC2B pAb (ATL-HPA064301) Datasheet (External Link)
Vendor Page Anti PRRC2B pAb (ATL-HPA064301)