Anti PRRC2A pAb (ATL-HPA046791)

Atlas Antibodies

SKU:
ATL-HPA046791-25
  • Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: proline-rich coiled-coil 2A
Gene Name: PRRC2A
Alternative Gene Name: BAT2, D6S51E, G2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024393: 76%, ENSRNOG00000000852: 76%
Entrez Gene ID: 7916
Uniprot ID: P48634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDRGTEPGPIRPSHRPGPPVQFGTSDKDSDLRLVVGDSLKAEKELTASVTEAIPVSRDWELLPSAAASAEPQSKNLDSGHCVPEPSSSGQ
Gene Sequence TDRGTEPGPIRPSHRPGPPVQFGTSDKDSDLRLVVGDSLKAEKELTASVTEAIPVSRDWELLPSAAASAEPQSKNLDSGHCVPEPSSSGQ
Gene ID - Mouse ENSMUSG00000024393
Gene ID - Rat ENSRNOG00000000852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PRRC2A pAb (ATL-HPA046791)
Datasheet Anti PRRC2A pAb (ATL-HPA046791) Datasheet (External Link)
Vendor Page Anti PRRC2A pAb (ATL-HPA046791) at Atlas Antibodies

Documents & Links for Anti PRRC2A pAb (ATL-HPA046791)
Datasheet Anti PRRC2A pAb (ATL-HPA046791) Datasheet (External Link)
Vendor Page Anti PRRC2A pAb (ATL-HPA046791)